CDR2L polyclonal antibody
  • CDR2L polyclonal antibody

CDR2L polyclonal antibody

Ref: AB-PAB21469
CDR2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDR2L.
Información adicional
Size 100 uL
Gene Name CDR2L
Gene Alias HUMPPA
Gene Description cerebellar degeneration-related protein 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDR2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 30850
Iso type IgG

Enviar un mensaje


CDR2L polyclonal antibody

CDR2L polyclonal antibody