NUP88 polyclonal antibody
  • NUP88 polyclonal antibody

NUP88 polyclonal antibody

Ref: AB-PAB21456
NUP88 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUP88.
Información adicional
Size 100 uL
Gene Name NUP88
Gene Alias MGC8530
Gene Description nucleoporin 88kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QLLTRNVVFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYPSEILDPHVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUP88.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4927
Iso type IgG

Enviar un mensaje


NUP88 polyclonal antibody

NUP88 polyclonal antibody