MAMDC2 polyclonal antibody
  • MAMDC2 polyclonal antibody

MAMDC2 polyclonal antibody

Ref: AB-PAB21455
MAMDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAMDC2.
Información adicional
Size 100 uL
Gene Name MAMDC2
Gene Alias MGC21981
Gene Description MAM domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IFEENHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKVVFMSLCKSFWDCGLVALDDITIQLGSCSSSEKLPPPPGECTFEQDECTFTQEKRNRSSWHRRRGETPTSYTGPKGDHTTGVGYYMYIEASHM
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAMDC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 256691
Iso type IgG

Enviar un mensaje


MAMDC2 polyclonal antibody

MAMDC2 polyclonal antibody