RBM33 polyclonal antibody
  • RBM33 polyclonal antibody

RBM33 polyclonal antibody

Ref: AB-PAB21450
RBM33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM33.
Información adicional
Size 100 uL
Gene Name RBM33
Gene Alias DKFZp434D1319|MGC20460|PRR8
Gene Description RNA binding motif protein 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QHPPQHQHHHHHHHLSVPPPPLMPMSQPQFRPHVQTAQPQASSSRMQCPQRQGLRHNTTSQNVSKRPMQQMQPTAPRNSNLREL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM33.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 155435
Iso type IgG

Enviar un mensaje


RBM33 polyclonal antibody

RBM33 polyclonal antibody