INTS1 polyclonal antibody
  • INTS1 polyclonal antibody

INTS1 polyclonal antibody

Ref: AB-PAB21441
INTS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INTS1.
Información adicional
Size 100 uL
Gene Name INTS1
Gene Alias DKFZp586J0619|FLJ46624|INT1|KIAA1440
Gene Description integrator complex subunit 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INTS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26173
Iso type IgG

Enviar un mensaje


INTS1 polyclonal antibody

INTS1 polyclonal antibody