PMPCA polyclonal antibody
  • PMPCA polyclonal antibody

PMPCA polyclonal antibody

Ref: AB-PAB21437
PMPCA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PMPCA.
Información adicional
Size 100 uL
Gene Name PMPCA
Gene Alias Alpha-MPP|FLJ26258|INPP5E|KIAA0123|MGC104197
Gene Description peptidase (mitochondrial processing) alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMFSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PMPCA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23203
Iso type IgG

Enviar un mensaje


PMPCA polyclonal antibody

PMPCA polyclonal antibody