SGSM2 polyclonal antibody Ver mas grande

SGSM2 polyclonal antibody

AB-PAB21436

Producto nuevo

SGSM2 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name SGSM2
Gene Alias KIAA0397|RUTBC1
Gene Description small G protein signaling modulator 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SGSM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9905
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant SGSM2.

Consulta sobre un producto

SGSM2 polyclonal antibody

SGSM2 polyclonal antibody