ANKFN1 polyclonal antibody Ver mas grande

ANKFN1 polyclonal antibody

AB-PAB21431

Producto nuevo

ANKFN1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name ANKFN1
Gene Alias FLJ38335
Gene Description ankyrin-repeat and fibronectin type III domain containing 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLTMGQQYFVQVSAYNMKGWGPAQTTTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVSRSLKHLF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKFN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162282
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant ANKFN1.

Consulta sobre un producto

ANKFN1 polyclonal antibody

ANKFN1 polyclonal antibody