ZBTB10 polyclonal antibody
  • ZBTB10 polyclonal antibody

ZBTB10 polyclonal antibody

Ref: AB-PAB21428
ZBTB10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZBTB10.
Información adicional
Size 100 uL
Gene Name ZBTB10
Gene Alias FLJ12752|RINZF
Gene Description zinc finger and BTB domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZBTB10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65986
Iso type IgG

Enviar un mensaje


ZBTB10 polyclonal antibody

ZBTB10 polyclonal antibody