FLJ21865 polyclonal antibody
  • FLJ21865 polyclonal antibody

FLJ21865 polyclonal antibody

Ref: AB-PAB21427
FLJ21865 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLJ21865.
Información adicional
Size 100 uL
Gene Name FLJ21865
Gene Alias DKFZp434P174|ENGase
Gene Description endo-beta-N-acetylglucosaminidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLJ21865.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64772
Iso type IgG

Enviar un mensaje


FLJ21865 polyclonal antibody

FLJ21865 polyclonal antibody