LRCH1 polyclonal antibody
  • LRCH1 polyclonal antibody

LRCH1 polyclonal antibody

Ref: AB-PAB21424
LRCH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRCH1.
Información adicional
Size 100 uL
Gene Name LRCH1
Gene Alias CHDC1|KIAA1016
Gene Description leucine-rich repeats and calponin homology (CH) domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKATTAEDC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRCH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23143
Iso type IgG

Enviar un mensaje


LRCH1 polyclonal antibody

LRCH1 polyclonal antibody