SVEP1 polyclonal antibody
  • SVEP1 polyclonal antibody

SVEP1 polyclonal antibody

Ref: AB-PAB21421
SVEP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SVEP1.
Información adicional
Size 100 uL
Gene Name SVEP1
Gene Alias C9orf13|CCP22|FLJ16013|FLJ90719|POLYDOM|SEL-OB|SELOB
Gene Description sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SVEP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79987
Iso type IgG

Enviar un mensaje


SVEP1 polyclonal antibody

SVEP1 polyclonal antibody