RBM33 polyclonal antibody Ver mas grande

RBM33 polyclonal antibody

AB-PAB21419

Producto nuevo

RBM33 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name RBM33
Gene Alias DKFZp434D1319|MGC20460|PRR8
Gene Description RNA binding motif protein 33
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AGARKKELLERLAQQQQQLYAPPPPAEQEEQALSPSPTNGNPLLPFPGAQVRQNVKNRLLVKNQDVSISNVQPKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM33.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 155435
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant RBM33.

Consulta sobre un producto

RBM33 polyclonal antibody

RBM33 polyclonal antibody