CYTSB polyclonal antibody
  • CYTSB polyclonal antibody

CYTSB polyclonal antibody

Ref: AB-PAB21406
CYTSB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CYTSB.
Información adicional
Size 100 uL
Gene Name CYTSB
Gene Alias FLJ36955|HCMOGT-1|NSP|SPECC1
Gene Description cytospin B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CYTSB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92521
Iso type IgG

Enviar un mensaje


CYTSB polyclonal antibody

CYTSB polyclonal antibody