FAM129B polyclonal antibody
  • FAM129B polyclonal antibody

FAM129B polyclonal antibody

Ref: AB-PAB21405
FAM129B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM129B.
Información adicional
Size 100 uL
Gene Name FAM129B
Gene Alias C9orf88|DKFZP434H0820|FLJ13518|FLJ22151|FLJ22298|MEG-3|OC58|bA356B19.6
Gene Description family with sequence similarity 129, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM129B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64855
Iso type IgG

Enviar un mensaje


FAM129B polyclonal antibody

FAM129B polyclonal antibody