MRPL27 polyclonal antibody
  • MRPL27 polyclonal antibody

MRPL27 polyclonal antibody

Ref: AB-PAB21404
MRPL27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL27.
Información adicional
Size 100 uL
Gene Name MRPL27
Gene Alias L27mt|MGC23716
Gene Description mitochondrial ribosomal protein L27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51264
Iso type IgG

Enviar un mensaje


MRPL27 polyclonal antibody

MRPL27 polyclonal antibody