BLOC1S1 polyclonal antibody
  • BLOC1S1 polyclonal antibody

BLOC1S1 polyclonal antibody

Ref: AB-PAB21399
BLOC1S1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BLOC1S1.
Información adicional
Size 100 uL
Gene Name BLOC1S1
Gene Alias BLOS1|FLJ39337|FLJ97089|GCN5L1|MGC87455|MICoA|RT14
Gene Description biogenesis of lysosomal organelles complex-1, subunit 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BLOC1S1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2647
Iso type IgG

Enviar un mensaje


BLOC1S1 polyclonal antibody

BLOC1S1 polyclonal antibody