SAMD9 polyclonal antibody
  • SAMD9 polyclonal antibody

SAMD9 polyclonal antibody

Ref: AB-PAB21388
SAMD9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAMD9.
Información adicional
Size 100 uL
Gene Name SAMD9
Gene Alias C7orf5|FLJ20073|KIAA2004|NFTC|OEF1|OEF2
Gene Description sterile alpha motif domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VSQKERRETSKQKQKGKENPDMANPSAMSTTAKGSKSLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFSNPYRYKLDFSLQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAMD9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54809
Iso type IgG

Enviar un mensaje


SAMD9 polyclonal antibody

SAMD9 polyclonal antibody