RUSC2 polyclonal antibody
  • RUSC2 polyclonal antibody

RUSC2 polyclonal antibody

Ref: AB-PAB21382
RUSC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RUSC2.
Información adicional
Size 100 uL
Gene Name RUSC2
Gene Alias Iporin|KIAA0375
Gene Description RUN and SH3 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPSPFESKMSYESHHPESGGREGGYGCPHASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSCSEEHTKISP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RUSC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9853
Iso type IgG

Enviar un mensaje


RUSC2 polyclonal antibody

RUSC2 polyclonal antibody