C9orf102 polyclonal antibody
  • C9orf102 polyclonal antibody

C9orf102 polyclonal antibody

Ref: AB-PAB21377
C9orf102 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf102.
Información adicional
Size 100 uL
Gene Name C9orf102
Gene Alias FLJ37706|MGC30192|MGC43364|RAD26L|SR278
Gene Description chromosome 9 open reading frame 102
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLSDSETLSFKDSTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf102.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375748
Iso type IgG

Enviar un mensaje


C9orf102 polyclonal antibody

C9orf102 polyclonal antibody