MYO1G polyclonal antibody
  • MYO1G polyclonal antibody

MYO1G polyclonal antibody

Ref: AB-PAB21375
MYO1G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYO1G.
Información adicional
Size 100 uL
Gene Name MYO1G
Gene Alias HA-2|MGC142104
Gene Description myosin IG
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO1G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64005
Iso type IgG

Enviar un mensaje


MYO1G polyclonal antibody

MYO1G polyclonal antibody