PTAR1 polyclonal antibody
  • PTAR1 polyclonal antibody

PTAR1 polyclonal antibody

Ref: AB-PAB21374
PTAR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PTAR1.
Información adicional
Size 100 uL
Gene Name PTAR1
Gene Alias FLJ45604
Gene Description protein prenyltransferase alpha subunit repeat containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PADSPGGTLSDLHLIPAGSQLSQAMEVDGLNDSSKQGYSQETKRLKRTPVPDSLGLEMEHRFIDQVLSTCRNVEQARFASAYRKWLVTLSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PTAR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375743
Iso type IgG

Enviar un mensaje


PTAR1 polyclonal antibody

PTAR1 polyclonal antibody