KRBA1 polyclonal antibody
  • KRBA1 polyclonal antibody

KRBA1 polyclonal antibody

Ref: AB-PAB21372
KRBA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KRBA1.
Información adicional
Size 100 uL
Gene Name KRBA1
Gene Alias KIAA1862|MGC176633
Gene Description KRAB-A domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq INCLKEILVPGPRHPETSPSFLPPLPSLGTSRLTRADLGPGSPPWAVKTEAVSGDCPLQGLLHCLKELPEAQDRHPSPSGVGNRRLQENPGAWKRGSGGPGYLLTPPPHPDLGAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KRBA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84626
Iso type IgG

Enviar un mensaje


KRBA1 polyclonal antibody

KRBA1 polyclonal antibody