FAM180A polyclonal antibody
  • FAM180A polyclonal antibody

FAM180A polyclonal antibody

Ref: AB-PAB21369
FAM180A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM180A.
Información adicional
Size 100 uL
Gene Name FAM180A
Gene Alias UNQ1940
Gene Description family with sequence similarity 180, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM180A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389558
Iso type IgG

Enviar un mensaje


FAM180A polyclonal antibody

FAM180A polyclonal antibody