OLFML2A polyclonal antibody Ver mas grande

OLFML2A polyclonal antibody

AB-PAB21363

Producto nuevo

OLFML2A polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name OLFML2A
Gene Alias FLJ00237|PRO34319
Gene Description olfactomedin-like 2A
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMKDPAARDDRIYVTNYYY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OLFML2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 169611
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant OLFML2A.

Consulta sobre un producto

OLFML2A polyclonal antibody

OLFML2A polyclonal antibody