OLFML2A polyclonal antibody
  • OLFML2A polyclonal antibody

OLFML2A polyclonal antibody

Ref: AB-PAB21363
OLFML2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OLFML2A.
Información adicional
Size 100 uL
Gene Name OLFML2A
Gene Alias FLJ00237|PRO34319
Gene Description olfactomedin-like 2A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMKDPAARDDRIYVTNYYY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OLFML2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 169611
Iso type IgG

Enviar un mensaje


OLFML2A polyclonal antibody

OLFML2A polyclonal antibody