TMEM53 polyclonal antibody
  • TMEM53 polyclonal antibody

TMEM53 polyclonal antibody

Ref: AB-PAB21359
TMEM53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM53.
Información adicional
Size 100 uL
Gene Name TMEM53
Gene Alias FLJ22353|NET4
Gene Description transmembrane protein 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79639
Iso type IgG

Enviar un mensaje


TMEM53 polyclonal antibody

TMEM53 polyclonal antibody