KBTBD2 polyclonal antibody
  • KBTBD2 polyclonal antibody

KBTBD2 polyclonal antibody

Ref: AB-PAB21358
KBTBD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KBTBD2.
Información adicional
Size 100 uL
Gene Name KBTBD2
Gene Alias BKLHD1
Gene Description kelch repeat and BTB (POZ) domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPNDKSVVVQGLYKSMPKFFKPRLGMTKEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCSPPADLHKVGTVVTPDND
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KBTBD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25948
Iso type IgG

Enviar un mensaje


KBTBD2 polyclonal antibody

KBTBD2 polyclonal antibody