MYO18A polyclonal antibody
  • MYO18A polyclonal antibody

MYO18A polyclonal antibody

Ref: AB-PAB21356
MYO18A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYO18A.
Información adicional
Size 100 uL
Gene Name MYO18A
Gene Alias DKFZp686L0243|KIAA0216|MYSPDZ|SPR210
Gene Description myosin XVIIIA
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQACRRVVHFAEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO18A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 399687
Iso type IgG

Enviar un mensaje


MYO18A polyclonal antibody

MYO18A polyclonal antibody