TPP2 polyclonal antibody
  • TPP2 polyclonal antibody

TPP2 polyclonal antibody

Ref: AB-PAB21353
TPP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TPP2.
Información adicional
Size 100 uL
Gene Name TPP2
Gene Alias FLJ40359
Gene Description tripeptidyl peptidase II
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TPP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7174
Iso type IgG

Enviar un mensaje


TPP2 polyclonal antibody

TPP2 polyclonal antibody