C7orf59 polyclonal antibody
  • C7orf59 polyclonal antibody

C7orf59 polyclonal antibody

Ref: AB-PAB21346
C7orf59 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf59.
Información adicional
Size 100 uL
Gene Name C7orf59
Gene Alias MGC163425|MGC163431
Gene Description chromosome 7 open reading frame 59
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf59.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389541
Iso type IgG

Enviar un mensaje


C7orf59 polyclonal antibody

C7orf59 polyclonal antibody