KIAA1045 polyclonal antibody
  • KIAA1045 polyclonal antibody

KIAA1045 polyclonal antibody

Ref: AB-PAB21342
KIAA1045 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1045.
Información adicional
Size 100 uL
Gene Name KIAA1045
Gene Alias DKFZp434I2112|RP11-392A14.4
Gene Description KIAA1045
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1045.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23349
Iso type IgG

Enviar un mensaje


KIAA1045 polyclonal antibody

KIAA1045 polyclonal antibody