C9orf75 polyclonal antibody
  • C9orf75 polyclonal antibody

C9orf75 polyclonal antibody

Ref: AB-PAB21336
C9orf75 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf75.
Información adicional
Size 100 uL
Gene Name C9orf75
Gene Alias FLJ90254|MGC131933|RP11-350O14.7
Gene Description chromosome 9 open reading frame 75
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ADRAIRWQRPSSPPPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQAAKLPYLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf75.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286262
Iso type IgG

Enviar un mensaje


C9orf75 polyclonal antibody

C9orf75 polyclonal antibody