ZNF20 polyclonal antibody
  • ZNF20 polyclonal antibody

ZNF20 polyclonal antibody

Ref: AB-PAB21335
ZNF20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF20.
Información adicional
Size 100 uL
Gene Name ZNF20
Gene Alias FLJ39241|KOX13
Gene Description zinc finger protein 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MFQDSVAFEDVAVSFTQEEWALLDPSQKNLYRDVMQETFKNLTSVGKTWKVQNIEDEYKNPRRNLSLMREKLCESKESHHCGESFNQIADDMLNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7568
Iso type IgG

Enviar un mensaje


ZNF20 polyclonal antibody

ZNF20 polyclonal antibody