GGCT polyclonal antibody
  • GGCT polyclonal antibody

GGCT polyclonal antibody

Ref: AB-PAB21330
GGCT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GGCT.
Información adicional
Size 100 uL
Gene Name GGCT
Gene Alias C7orf24|CRF21|FLJ11717|GCTG|Ggc|MGC3077
Gene Description gamma-glutamyl cyclotransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GGCT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79017
Iso type IgG

Enviar un mensaje


GGCT polyclonal antibody

GGCT polyclonal antibody