GFRA3 polyclonal antibody
  • GFRA3 polyclonal antibody

GFRA3 polyclonal antibody

Ref: AB-PAB21328
GFRA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GFRA3.
Información adicional
Size 100 uL
Gene Name GFRA3
Gene Alias -
Gene Description GDNF family receptor alpha 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GFRA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2676
Iso type IgG

Enviar un mensaje


GFRA3 polyclonal antibody

GFRA3 polyclonal antibody