C9orf16 polyclonal antibody
  • C9orf16 polyclonal antibody

C9orf16 polyclonal antibody

Ref: AB-PAB21326
C9orf16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf16.
Información adicional
Size 100 uL
Gene Name C9orf16
Gene Alias EST00098|FLJ12823|MGC4639
Gene Description chromosome 9 open reading frame 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79095
Iso type IgG

Enviar un mensaje


C9orf16 polyclonal antibody

C9orf16 polyclonal antibody