SLCO2B1 polyclonal antibody
  • SLCO2B1 polyclonal antibody

SLCO2B1 polyclonal antibody

Ref: AB-PAB21325
SLCO2B1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLCO2B1.
Información adicional
Size 100 uL
Gene Name SLCO2B1
Gene Alias DKFZp686E0517|KIAA0880|OATP-B|OATP2B1|OATPB|SLC21A9
Gene Description solute carrier organic anion transporter family, member 2B1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLCO2B1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11309
Iso type IgG

Enviar un mensaje


SLCO2B1 polyclonal antibody

SLCO2B1 polyclonal antibody