KIAA1958 polyclonal antibody
  • KIAA1958 polyclonal antibody

KIAA1958 polyclonal antibody

Ref: AB-PAB21317
KIAA1958 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1958.
Información adicional
Size 100 uL
Gene Name KIAA1958
Gene Alias FLJ39294|MGC142075
Gene Description KIAA1958
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LIPNLKHLLSEGSHGNLTAMWGCSAGHAYHWPLTATCRAGSQERVCFQDNRSFNSDSPSIIGVPSETQTSPVERYPGRPVKAKLDCNRTRDSCDFSYCSEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1958.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158405
Iso type IgG

Enviar un mensaje


KIAA1958 polyclonal antibody

KIAA1958 polyclonal antibody