LRRC72 polyclonal antibody
  • LRRC72 polyclonal antibody

LRRC72 polyclonal antibody

Ref: AB-PAB21313
LRRC72 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC72.
Información adicional
Size 100 uL
Gene Name LRRC72
Gene Alias -
Gene Description leucine rich repeat containing 72
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTETAQMLTVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC72.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100506049
Iso type IgG

Enviar un mensaje


LRRC72 polyclonal antibody

LRRC72 polyclonal antibody