LOC136242 polyclonal antibody
  • LOC136242 polyclonal antibody

LOC136242 polyclonal antibody

Ref: AB-PAB21312
LOC136242 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC136242.
Información adicional
Size 100 uL
Gene Name LOC136242
Gene Alias -
Gene Description Peptidase S1 domain-containing protein LOC136242
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC136242.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 136242
Iso type IgG

Enviar un mensaje


LOC136242 polyclonal antibody

LOC136242 polyclonal antibody