NSUN5 polyclonal antibody
  • NSUN5 polyclonal antibody

NSUN5 polyclonal antibody

Ref: AB-PAB21311
NSUN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSUN5.
Información adicional
Size 100 uL
Gene Name NSUN5
Gene Alias FLJ10267|MGC986|NOL1|NOL1R|NSUN5A|WBSCR20|WBSCR20A|Ynl022cL|p120
Gene Description NOL1/NOP2/Sun domain family, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSUN5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55695
Iso type IgG

Enviar un mensaje


NSUN5 polyclonal antibody

NSUN5 polyclonal antibody