LRRC8E polyclonal antibody
  • LRRC8E polyclonal antibody

LRRC8E polyclonal antibody

Ref: AB-PAB21305
LRRC8E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC8E.
Información adicional
Size 100 uL
Gene Name LRRC8E
Gene Alias FLJ23420
Gene Description leucine rich repeat containing 8 family, member E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLRQKLQRNAAGRLELALCMLPGLPDTVFELSEVESLRLEAICDITFPPGLSQLVHLQELSLLHSPARLPFSLQVFLRDHLKVMRVKCEELREVPLWVFGLRGLEELHLEGLFPQELARAATL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC8E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80131
Iso type IgG

Enviar un mensaje


LRRC8E polyclonal antibody

LRRC8E polyclonal antibody