MUM1L1 polyclonal antibody
  • MUM1L1 polyclonal antibody

MUM1L1 polyclonal antibody

Ref: AB-PAB21304
MUM1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MUM1L1.
Información adicional
Size 100 uL
Gene Name MUM1L1
Gene Alias FLJ33516|MGC129994|MGC129995
Gene Description melanoma associated antigen (mutated) 1-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AVMSVHSAVKEESACVKDEKFAPPLSPLSSDMLIMPKALKEESEDTCLETLAVPSECSAFSENIEDPGEGPSNPCLDTSQNQPSMESEMGAAACPGSCSRECEVSFSASNPVWDYSHLMSSERNFQRLDFEELEEEGQASDKSLLPSRI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MUM1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 139221
Iso type IgG

Enviar un mensaje


MUM1L1 polyclonal antibody

MUM1L1 polyclonal antibody