KLHDC1 polyclonal antibody
  • KLHDC1 polyclonal antibody

KLHDC1 polyclonal antibody

Ref: AB-PAB21303
KLHDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHDC1.
Información adicional
Size 100 uL
Gene Name KLHDC1
Gene Alias MGC126644|MGC126646|MST025
Gene Description kelch domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKTRPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDCIGKNSIMLESQISLLPPKLLQQVLKKITFWAAANHREEQRVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 122773
Iso type IgG

Enviar un mensaje


KLHDC1 polyclonal antibody

KLHDC1 polyclonal antibody