GCAT polyclonal antibody
  • GCAT polyclonal antibody

GCAT polyclonal antibody

Ref: AB-PAB21302
GCAT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GCAT.
Información adicional
Size 100 uL
Gene Name GCAT
Gene Alias KBL|MGC23053
Gene Description glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GCAT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23464
Iso type IgG

Enviar un mensaje


GCAT polyclonal antibody

GCAT polyclonal antibody