MPP6 polyclonal antibody Ver mas grande

MPP6 polyclonal antibody

AB-PAB21301

Producto nuevo

MPP6 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name MPP6
Gene Alias PALS2|VAM-1|VAM1|p55T
Gene Description membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MPP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51678
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant MPP6.

Consulta sobre un producto

MPP6 polyclonal antibody

MPP6 polyclonal antibody