RASAL2 polyclonal antibody
  • RASAL2 polyclonal antibody

RASAL2 polyclonal antibody

Ref: AB-PAB21300
RASAL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RASAL2.
Información adicional
Size 100 uL
Gene Name RASAL2
Gene Alias MGC129919|nGAP
Gene Description RAS protein activator like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RASAL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9462
Iso type IgG

Enviar un mensaje


RASAL2 polyclonal antibody

RASAL2 polyclonal antibody