PKD1L1 polyclonal antibody
  • PKD1L1 polyclonal antibody

PKD1L1 polyclonal antibody

Ref: AB-PAB21296
PKD1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PKD1L1.
Información adicional
Size 100 uL
Gene Name PKD1L1
Gene Alias PRO19563
Gene Description polycystic kidney disease 1 like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SDDQERCLQAACCLSFGGELSVSTDKSWGLHLCSCSPPGGGLWVEVYANHVLLMSDGKCGCPWCALNGKAEDRESQSPSSSASRQKNIWKTTSEAALSVVNEKTQAVVNEKTQAPLDCDNSAD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PKD1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 168507
Iso type IgG

Enviar un mensaje


PKD1L1 polyclonal antibody

PKD1L1 polyclonal antibody