ZC3HAV1L polyclonal antibody
  • ZC3HAV1L polyclonal antibody

ZC3HAV1L polyclonal antibody

Ref: AB-PAB21290
ZC3HAV1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZC3HAV1L.
Información adicional
Size 100 uL
Gene Name ZC3HAV1L
Gene Alias C7orf39|MGC14289
Gene Description zinc finger CCCH-type, antiviral 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CKRSHQLIHAASLKLLQDQGLNIPSVVNFQIISTYKHMKLHKMLENTDNSSPSTEHSQGLEKQGVHAAGAAEAGPLASVPAQSAKKPCPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZC3HAV1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92092
Iso type IgG

Enviar un mensaje


ZC3HAV1L polyclonal antibody

ZC3HAV1L polyclonal antibody