COG5 polyclonal antibody
  • COG5 polyclonal antibody

COG5 polyclonal antibody

Ref: AB-PAB21288
COG5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COG5.
Información adicional
Size 100 uL
Gene Name COG5
Gene Alias GOLTC1|GTC90
Gene Description component of oligomeric golgi complex 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COG5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10466
Iso type IgG

Enviar un mensaje


COG5 polyclonal antibody

COG5 polyclonal antibody